Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00051738-M08 |
Product name: | GHRL monoclonal antibody (M08), clone 3B8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant GHRL. |
Clone: | 3B8 |
Isotype: | IgG2a Kappa |
Gene id: | 51738 |
Gene name: | GHRL |
Gene alias: | MTLRP|obestatin |
Gene description: | ghrelin/obestatin prepropeptide |
Genbank accession: | BC025791 |
Immunogen: | GHRL (AAH25791.1, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK |
Protein accession: | AAH25791.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of GHRL expression in transfected 293T cell line by GHRL monoclonal antibody (M08), clone 3B8. Lane 1: GHRL transfected lysate(12.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |