GHRL monoclonal antibody (M03), clone 3C9 View larger

GHRL monoclonal antibody (M03), clone 3C9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GHRL monoclonal antibody (M03), clone 3C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GHRL monoclonal antibody (M03), clone 3C9

Brand: Abnova
Reference: H00051738-M03
Product name: GHRL monoclonal antibody (M03), clone 3C9
Product description: Mouse monoclonal antibody raised against a full length recombinant GHRL.
Clone: 3C9
Isotype: IgG2a Kappa
Gene id: 51738
Gene name: GHRL
Gene alias: MTLRP|obestatin
Gene description: ghrelin/obestatin prepropeptide
Genbank accession: BC025791
Immunogen: GHRL (AAH25791.1, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Protein accession: AAH25791.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051738-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.61 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051738-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GHRL is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GHRL monoclonal antibody (M03), clone 3C9 now

Add to cart