View larger

POLR3K purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of POLR3K purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00051728-D01P
Product name:	POLR3K purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human POLR3K protein.
Gene id:	51728
Gene name:	POLR3K
Gene alias:	C11\|C11-RNP3\|My010\|RPC10\|RPC11\|hRPC11
Gene description:	polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
Genbank accession:	NM_016310.2
Immunogen:	POLR3K (NP_057394.1, 1 a.a. ~ 108 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Protein accession:	NP_057394.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of POLR3K expression in transfected 293T cell line (H00051728-T03) by POLR3K MaxPab polyclonal antibody. Lane 1: POLR3K transfected lysate(12.30 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice