Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00051728-B02 |
Product name: | POLR3K MaxPab mouse polyclonal antibody (B02) |
Product description: | Mouse polyclonal antibody raised against a full-length human POLR3K protein. |
Gene id: | 51728 |
Gene name: | POLR3K |
Gene alias: | C11|C11-RNP3|My010|RPC10|RPC11|hRPC11 |
Gene description: | polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa |
Genbank accession: | NM_016310.2 |
Immunogen: | POLR3K (NP_057394.1, 1 a.a. ~ 108 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
Protein accession: | NP_057394.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POLR3K expression in transfected 293T cell line (H00051728-T02) by POLR3K MaxPab polyclonal antibody. Lane 1: POLR3K transfected lysate(11.88 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |