Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of POLR3K MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about POLR3K MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00051728-B01 |
| Product name: | POLR3K MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human POLR3K protein. |
| Gene id: | 51728 |
| Gene name: | POLR3K |
| Gene alias: | C11|C11-RNP3|My010|RPC10|RPC11|hRPC11 |
| Gene description: | polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa |
| Genbank accession: | BC011932 |
| Immunogen: | POLR3K (AAH11932, 1 a.a. ~ 108 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
| Protein accession: | AAH11932 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of POLR3K expression in transfected 293T cell line (H00051728-T01) by POLR3K MaxPab polyclonal antibody. Lane 1: POLR3K transfected lysate(11.99 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |