RAB23 MaxPab mouse polyclonal antibody (B01) View larger

RAB23 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB23 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about RAB23 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00051715-B01
Product name: RAB23 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RAB23 protein.
Gene id: 51715
Gene name: RAB23
Gene alias: DKFZp781H0695|HSPC137|MGC8900
Gene description: RAB23, member RAS oncogene family
Genbank accession: BC015021
Immunogen: RAB23 (AAH15021, 1 a.a. ~ 237 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
Protein accession: AAH15021
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051715-B01-13-15-1.jpg
Application image note: Western Blot analysis of RAB23 expression in transfected 293T cell line (H00051715-T01) by RAB23 MaxPab polyclonal antibody.

Lane 1: RAB23 transfected lysate(26.18 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB23 MaxPab mouse polyclonal antibody (B01) now

Add to cart