Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ZNF44 monoclonal antibody (M01), clone 4E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ZNF44 monoclonal antibody (M01), clone 4E2
| Brand: | Abnova |
| Reference: | H00051710-M01 |
| Product name: | ZNF44 monoclonal antibody (M01), clone 4E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNF44. |
| Clone: | 4E2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51710 |
| Gene name: | ZNF44 |
| Gene alias: | DKFZp434F1811|DKFZp686L21136|GIOT-2|KOX7|ZNF|ZNF504|ZNF55|ZNF58 |
| Gene description: | zinc finger protein 44 |
| Genbank accession: | NM_016264 |
| Immunogen: | ZNF44 (NP_057348.2, 1 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALCYGTFWGYPKMLEAANLMEGLVDIGPWVTLPRGQPEVLEWGLPKDQDSVAFEDVAVNFTHEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWENQNIDDQ |
| Protein accession: | NP_057348.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ZNF44 expression in transfected 293T cell line by ZNF44 monoclonal antibody (M01), clone 4E2. Lane 1: ZNF44 transfected lysate(17.5 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |