No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ce,WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00051706-D01P |
Product name: | CYB5R1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CYB5R1 protein. |
Gene id: | 51706 |
Gene name: | CYB5R1 |
Gene alias: | B5R.1|NQO3A2|humb5R2 |
Gene description: | cytochrome b5 reductase 1 |
Genbank accession: | NM_016243.2 |
Immunogen: | CYB5R1 (NP_057327.2, 1 a.a. ~ 305 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY |
Protein accession: | NP_057327.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CYB5R1 expression in transfected 293T cell line (H00051706-T01) by CYB5R1 MaxPab polyclonal antibody. Lane 1: CYB5R1 transfected lysate(34.10 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |