CYB5R1 purified MaxPab mouse polyclonal antibody (B01P) View larger

CYB5R1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYB5R1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CYB5R1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00051706-B01P
Product name: CYB5R1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CYB5R1 protein.
Gene id: 51706
Gene name: CYB5R1
Gene alias: B5R.1|NQO3A2|humb5R2
Gene description: cytochrome b5 reductase 1
Genbank accession: NM_016243.2
Immunogen: CYB5R1 (NP_057327.2, 1 a.a. ~ 305 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
Protein accession: NP_057327.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051706-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CYB5R1 expression in transfected 293T cell line (H00051706-T01) by CYB5R1 MaxPab polyclonal antibody.

Lane 1: CYB5R1 transfected lysate(33.55 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CYB5R1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart