GPRC5B monoclonal antibody (M04), clone 1H1 View larger

GPRC5B monoclonal antibody (M04), clone 1H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPRC5B monoclonal antibody (M04), clone 1H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about GPRC5B monoclonal antibody (M04), clone 1H1

Brand: Abnova
Reference: H00051704-M04
Product name: GPRC5B monoclonal antibody (M04), clone 1H1
Product description: Mouse monoclonal antibody raised against a partial recombinant GPRC5B.
Clone: 1H1
Isotype: IgG1 Kappa
Gene id: 51704
Gene name: GPRC5B
Gene alias: RAIG-2|RAIG2
Gene description: G protein-coupled receptor, family C, group 5, member B
Genbank accession: NM_016235
Immunogen: GPRC5B (NP_057319.1, 302 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW
Protein accession: NP_057319.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051704-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051704-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged GPRC5B is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GPRC5B monoclonal antibody (M04), clone 1H1 now

Add to cart