Brand: | Abnova |
Reference: | H00051704-M04 |
Product name: | GPRC5B monoclonal antibody (M04), clone 1H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GPRC5B. |
Clone: | 1H1 |
Isotype: | IgG1 Kappa |
Gene id: | 51704 |
Gene name: | GPRC5B |
Gene alias: | RAIG-2|RAIG2 |
Gene description: | G protein-coupled receptor, family C, group 5, member B |
Genbank accession: | NM_016235 |
Immunogen: | GPRC5B (NP_057319.1, 302 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW |
Protein accession: | NP_057319.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GPRC5B is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |