Brand: | Abnova |
Reference: | H00051701-M02 |
Product name: | NLK monoclonal antibody (M02), clone 2B11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NLK. |
Clone: | 2B11 |
Isotype: | IgG1 Kappa |
Gene id: | 51701 |
Gene name: | NLK |
Gene alias: | DKFZp761G1211|FLJ21033 |
Gene description: | nemo-like kinase |
Genbank accession: | BC064663 |
Immunogen: | NLK (AAH64663, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE |
Protein accession: | AAH64663 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Proximity Ligation Analysis of protein-protein interactions between MAP3K7 and NLK. HeLa cells were stained with anti-MAP3K7 rabbit purified polyclonal 1:1200 and anti-NLK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
Applications: | WB-Ti,ELISA,WB-Re,WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |