Brand: | Abnova |
Reference: | H00051692-M01 |
Product name: | CPSF3 monoclonal antibody (M01), clone 6E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CPSF3. |
Clone: | 6E6 |
Isotype: | IgG2a Kappa |
Gene id: | 51692 |
Gene name: | CPSF3 |
Gene alias: | CPSF|CPSF-73|CPSF73|YSH1 |
Gene description: | cleavage and polyadenylation specific factor 3, 73kDa |
Genbank accession: | NM_016207 |
Immunogen: | CPSF3 (NP_057291, 585 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH |
Protein accession: | NP_057291 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to CPSF3 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |