SUFU monoclonal antibody (M01), clone 1B2 View larger

SUFU monoclonal antibody (M01), clone 1B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SUFU monoclonal antibody (M01), clone 1B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,PLA-Ce

More info about SUFU monoclonal antibody (M01), clone 1B2

Brand: Abnova
Reference: H00051684-M01
Product name: SUFU monoclonal antibody (M01), clone 1B2
Product description: Mouse monoclonal antibody raised against a partial recombinant SUFU.
Clone: 1B2
Isotype: IgG2a Kappa
Gene id: 51684
Gene name: SUFU
Gene alias: PRO1280|SUFUH|SUFUXL
Gene description: suppressor of fused homolog (Drosophila)
Genbank accession: BC013291
Immunogen: SUFU (AAH13291, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSR
Protein accession: AAH13291
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051684-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SUFU is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy SUFU monoclonal antibody (M01), clone 1B2 now

Add to cart