FKBP7 MaxPab mouse polyclonal antibody (B02) View larger

FKBP7 MaxPab mouse polyclonal antibody (B02)

H00051661-B02_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FKBP7 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about FKBP7 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00051661-B02
Product name: FKBP7 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human FKBP7 protein.
Gene id: 51661
Gene name: FKBP7
Gene alias: FKBP23|MGC9420|PPIase
Gene description: FK506 binding protein 7
Genbank accession: NM_181342.1
Immunogen: FKBP7 (NP_851939.1, 1 a.a. ~ 222 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
Protein accession: NP_851939.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051661-B02-13-15-1.jpg
Application image note: Western Blot analysis of FKBP7 expression in transfected 293T cell line (H00051661-T01) by FKBP7 MaxPab polyclonal antibody.

Lane 1: FKBP7 transfected lysate(24.42 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FKBP7 MaxPab mouse polyclonal antibody (B02) now

Add to cart