Brand: | Abnova |
Reference: | H00051645-M01 |
Product name: | PPIL1 monoclonal antibody (M01), clone 2C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PPIL1. |
Clone: | 2C2 |
Isotype: | IgG2a Kappa |
Gene id: | 51645 |
Gene name: | PPIL1 |
Gene alias: | CGI-124|CYPL1|MGC678|PPIase|hCyPX |
Gene description: | peptidylprolyl isomerase (cyclophilin)-like 1 |
Genbank accession: | NM_016059 |
Immunogen: | PPIL1 (NP_057143, 76 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG |
Protein accession: | NP_057143 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PPIL1 monoclonal antibody (M01), clone 2C2 Western Blot analysis of PPIL1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |