Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of OTUD6B (Human) Recombinant Protein (P01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about OTUD6B (Human) Recombinant Protein (P01)
| Brand: | Abnova |
| Reference: | H00051633-P01 |
| Product name: | OTUD6B (Human) Recombinant Protein (P01) |
| Product description: | Human OTUD6B full-length ORF ( NP_057107.2, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 51633 |
| Gene name: | OTUD6B |
| Gene alias: | CGI-77|DUBA5 |
| Gene description: | OTU domain containing 6B |
| Genbank accession: | NM_016023.2 |
| Immunogen sequence/protein sequence: | MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENCS |
| Protein accession: | NP_057107.2 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mining the pre-diagnostic antibody repertoire of TgMMTV-neu mice to identify autoantibodies useful for the early detection of human breast cancer.Mao J, Ladd J, Gad E, Rastetter L, Johnson MM, Marzbani E, Childs JS, Lu H, Dang Y, Broussard E, Stanton SE, Hanash SM, Disis ML. Journal of Translational Medicine 2014, 12:121 doi:10.1186/1479-5876-12-121 |