TAF9B purified MaxPab rabbit polyclonal antibody (D01P) View larger

TAF9B purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAF9B purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about TAF9B purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00051616-D01P
Product name: TAF9B purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human TAF9B protein.
Gene id: 51616
Gene name: TAF9B
Gene alias: DN-7|DN7|TAF9L|TAFII31L|TFIID-31
Gene description: TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
Genbank accession: NM_015975.4
Immunogen: TAF9B (NP_057059.2, 1 a.a. ~ 251 a.a) full-length human protein.
Immunogen sequence/protein sequence: MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM
Protein accession: NP_057059.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00051616-D01P-13-15-1.jpg
Application image note: Western Blot analysis of TAF9B expression in transfected 293T cell line (H00051616-T01) by TAF9B MaxPab polyclonal antibody.

Lane 1: TAF9B transfected lysate(27.60 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TAF9B purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart