Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRIM33 monoclonal antibody (M01), clone 6D1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about TRIM33 monoclonal antibody (M01), clone 6D1
| Brand: | Abnova |
| Reference: | H00051592-M01 |
| Product name: | TRIM33 monoclonal antibody (M01), clone 6D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM33. |
| Clone: | 6D1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51592 |
| Gene name: | TRIM33 |
| Gene alias: | FLJ32925|PTC7|RFG7|TF1G|TIF1G|TIF1GAMMA|TIFGAMMA |
| Gene description: | tripartite motif-containing 33 |
| Genbank accession: | NM_015906 |
| Immunogen: | TRIM33 (NP_056990, 1006 a.a. ~ 1105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS |
| Protein accession: | NP_056990 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to TRIM33 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Tumour TIF1 mutations and loss of heterozygosity related to cancer-associated myositis.Pinal-Fernandez I, Ferrer-Fabregas B, Trallero-Araguas E, Balada E, Martinez MA, Milisenda JC, Aparicio-Espanol G, Labrador-Horrillo M, Garcia-Patos V, Grau-Junyent JM, Selva-OCallaghan A. Rheumatology (Oxford). 2017 Nov 14. [Epub ahead of print] |