Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PCQAP monoclonal antibody (M02), clone 4A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about PCQAP monoclonal antibody (M02), clone 4A4
| Brand: | Abnova |
| Reference: | H00051586-M02 |
| Product name: | PCQAP monoclonal antibody (M02), clone 4A4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCQAP. |
| Clone: | 4A4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51586 |
| Gene name: | MED15 |
| Gene alias: | ARC105|CAG7A|CTG7A|DKFZp686A2214|DKFZp762B1216|FLJ42282|FLJ42935|PCQAP|TIG-1|TIG1|TNRC7 |
| Gene description: | mediator complex subunit 15 |
| Genbank accession: | NM_015889 |
| Immunogen: | PCQAP (NP_056973, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL |
| Protein accession: | NP_056973 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to PCQAP on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.Varelas X, Sakuma R, Samavarchi-Tehrani P, Peerani R, Rao BM, Dembowy J, Yaffe MB, Zandstra PW, Wrana JL. Nat Cell Biol. 2008 Jul;10(7):837-48. Epub 2008 Jun 22. |