Brand: | Abnova |
Reference: | H00051566-M01 |
Product name: | ARMCX3 monoclonal antibody (M01), clone 2G3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ARMCX3. |
Clone: | 2G3 |
Isotype: | IgG2a Kappa |
Gene id: | 51566 |
Gene name: | ARMCX3 |
Gene alias: | ALEX3|DKFZp781N1954|KIAA0443|MGC12199|dJ545K15.2 |
Gene description: | armadillo repeat containing, X-linked 3 |
Genbank accession: | NM_016607 |
Immunogen: | ARMCX3 (NP_057691, 278 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE |
Protein accession: | NP_057691 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ARMCX3 is approximately 0.1ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |