Cart 192 Product Products 67 698,54 € (empty)
No products
To be determined Shipping
67 698,54 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 192 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 67 698,54 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 67 698,54 €
Data sheet of ARMCX3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about ARMCX3 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00051566-D01P |
| Product name: | ARMCX3 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ARMCX3 protein. |
| Gene id: | 51566 |
| Gene name: | ARMCX3 |
| Gene alias: | ALEX3|DKFZp781N1954|KIAA0443|MGC12199|dJ545K15.2 |
| Gene description: | armadillo repeat containing, X-linked 3 |
| Genbank accession: | NM_016607 |
| Immunogen: | ARMCX3 (NP_057691.1, 1 a.a. ~ 379 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE |
| Protein accession: | NP_057691.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ARMCX3 expression in transfected 293T cell line (H00051566-T02) by ARMCX3 MaxPab polyclonal antibody. Lane 1: ARMCX3 transfected lysate(42.50 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |