Brand: | Abnova |
Reference: | H00051561-M01 |
Product name: | IL23A monoclonal antibody (M01), clone 4C8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL23A. |
Clone: | 4C8 |
Isotype: | IgG2a Kappa |
Gene id: | 51561 |
Gene name: | IL23A |
Gene alias: | IL-23|IL-23A|IL23P19|MGC79388|P19|SGRF |
Gene description: | interleukin 23, alpha subunit p19 |
Genbank accession: | NM_016584.2 |
Immunogen: | IL23A (NP_057668.1, 1 a.a. ~ 189 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP |
Protein accession: | NP_057668.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (47.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | IL23A monoclonal antibody (M01), clone 4C8. Western Blot analysis of IL23A expression in human lung cancer. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |