PHF7 monoclonal antibody (M11), clone 1A7 View larger

PHF7 monoclonal antibody (M11), clone 1A7

H00051533-M11_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHF7 monoclonal antibody (M11), clone 1A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PHF7 monoclonal antibody (M11), clone 1A7

Brand: Abnova
Reference: H00051533-M11
Product name: PHF7 monoclonal antibody (M11), clone 1A7
Product description: Mouse monoclonal antibody raised against a partial recombinant PHF7.
Clone: 1A7
Isotype: IgG2a Kappa
Gene id: 51533
Gene name: PHF7
Gene alias: DKFZp434L1850|HSPC045|HSPC226|MGC26088|NYD-SP6
Gene description: PHD finger protein 7
Genbank accession: NM_016483
Immunogen: PHF7 (NP_057567.3, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPSLLEKPES
Protein accession: NP_057567.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051533-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051533-M11-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PHF7 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PHF7 monoclonal antibody (M11), clone 1A7 now

Add to cart