Brand: | Abnova |
Reference: | H00051533-M10 |
Product name: | PHF7 monoclonal antibody (M10), clone 1E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PHF7. |
Clone: | 1E9 |
Isotype: | IgG2a Kappa |
Gene id: | 51533 |
Gene name: | PHF7 |
Gene alias: | DKFZp434L1850|HSPC045|HSPC226|MGC26088|NYD-SP6 |
Gene description: | PHD finger protein 7 |
Genbank accession: | NM_016483 |
Immunogen: | PHF7 (NP_057567.3, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPSLLEKPES |
Protein accession: | NP_057567.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PHF7 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |