Brand: | Abnova |
Reference: | H00051529-M01 |
Product name: | ANAPC11 monoclonal antibody (M01), clone 1B4-1A4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant ANAPC11. |
Clone: | 1B4-1A4 |
Isotype: | IgG1 kappa |
Gene id: | 51529 |
Gene name: | ANAPC11 |
Gene alias: | APC11|Apc11p|HSPC214|MGC882 |
Gene description: | anaphase promoting complex subunit 11 |
Genbank accession: | BC000607 |
Immunogen: | ANAPC11 (AAH00607, 1 a.a. ~ 54 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE |
Protein accession: | AAH00607 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.68 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ANAPC11 is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |
Publications: | Integrated analysis highlights APC11 protein expression as a likely new independent predictive marker for colorectal cancer.Drouet Y, Treilleux I, Viari A, Leon S, Devouassoux-Shisheboran M, Voirin N, de la Fouchardiere C, Manship B, Puisieux A, Lasset C, Moyret-Lalle C. Sci Rep. 2018 May 9;8(1):7386. |