NCKIPSD monoclonal antibody (M07), clone 2E4 View larger

NCKIPSD monoclonal antibody (M07), clone 2E4

H00051517-M07_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCKIPSD monoclonal antibody (M07), clone 2E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about NCKIPSD monoclonal antibody (M07), clone 2E4

Brand: Abnova
Reference: H00051517-M07
Product name: NCKIPSD monoclonal antibody (M07), clone 2E4
Product description: Mouse monoclonal antibody raised against a partial recombinant NCKIPSD.
Clone: 2E4
Isotype: IgG2a Kappa
Gene id: 51517
Gene name: NCKIPSD
Gene alias: AF3P21|DIP|DIP1|MGC23891|ORF1|SPIN90|WASLBP|WISH
Gene description: NCK interacting protein with SH3 domain
Genbank accession: NM_184231
Immunogen: NCKIPSD (NP_909119.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGETGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHH
Protein accession: NP_909119.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051517-M07-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NCKIPSD is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy NCKIPSD monoclonal antibody (M07), clone 2E4 now

Add to cart