Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00051504-M09 |
Product name: | HSPC152 monoclonal antibody (M09), clone 3E5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HSPC152. |
Clone: | 3E5 |
Isotype: | IgG2a Kappa |
Gene id: | 51504 |
Gene name: | HSPC152 |
Gene alias: | - |
Gene description: | hypothetical protein HSPC152 |
Genbank accession: | BC017172 |
Immunogen: | HSPC152 (AAH17172, 1 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES |
Protein accession: | AAH17172 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (39.49 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HSPC152 expression in transfected 293T cell line by HSPC152 monoclonal antibody (M09), clone 3E5. Lane 1: HSPC152 transfected lysate(14.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |