Brand: | Abnova |
Reference: | H00051481-A01 |
Product name: | VCX3A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant VCX3A. |
Gene id: | 51481 |
Gene name: | VCX3A |
Gene alias: | MGC118976|MGC125730|MGC125796|VCX-8r|VCX-A|VCX3|VCX8R|VCXA |
Gene description: | variable charge, X-linked 3A |
Genbank accession: | NM_016379 |
Immunogen: | VCX3A (NP_057463, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SPKPRASGPPAKATEAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQ |
Protein accession: | NP_057463 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |