Brand: | Abnova |
Reference: | H00051477-A01 |
Product name: | ISYNA1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ISYNA1. |
Gene id: | 51477 |
Gene name: | ISYNA1 |
Gene alias: | INOS|IPS|Ino1 |
Gene description: | inositol-3-phosphate synthase 1 |
Genbank accession: | NM_016368 |
Immunogen: | ISYNA1 (NP_057452, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SYNHLGNNDGENLSAPLQFRSKEVSKSNVVDDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDSLLAAPIMLDL |
Protein accession: | NP_057452 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ISYNA1 polyclonal antibody (A01), Lot # 051123JC01 Western Blot analysis of ISYNA1 expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Myo-inositol phosphate synthase expression in the European eel (Anguilla anguilla) and Nile tilapia (Oreochromis niloticus): effect of seawater acclimation.Kalujnaia S, Hazon N, Cramb G. Am J Physiol Regul Integr Comp Physiol. 2016 Jun 1. [Epub ahead of print] |