Brand: | Abnova |
Reference: | H00051466-M02 |
Product name: | EVL monoclonal antibody (M02), clone 1D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EVL. |
Clone: | 1D6 |
Isotype: | IgG2a Kappa |
Gene id: | 51466 |
Gene name: | EVL |
Gene alias: | RNB6 |
Gene description: | Enah/Vasp-like |
Genbank accession: | NM_016337 |
Immunogen: | EVL (NP_057421, 309 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSPEAKSPLQSQPHSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT |
Protein accession: | NP_057421 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |