Brand: | Abnova |
Reference: | H00051465-M01 |
Product name: | UBE2J1 monoclonal antibody (M01), clone 6A12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2J1. |
Clone: | 6A12 |
Isotype: | IgG2a Kappa |
Gene id: | 51465 |
Gene name: | UBE2J1 |
Gene alias: | CGI-76|HSPC153|HSPC205|HSU93243|MGC12555|NCUBE1|Ubc6p |
Gene description: | ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast) |
Genbank accession: | NM_016021 |
Immunogen: | UBE2J1 (NP_003329, 9 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGF |
Protein accession: | NP_003329 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | UBE2J1 monoclonal antibody (M01), clone 6A12 Western Blot analysis of UBE2J1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |