UBE2J1 polyclonal antibody (A01) View larger

UBE2J1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2J1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about UBE2J1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00051465-A01
Product name: UBE2J1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant UBE2J1.
Gene id: 51465
Gene name: UBE2J1
Gene alias: CGI-76|HSPC153|HSPC205|HSU93243|MGC12555|NCUBE1|Ubc6p
Gene description: ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)
Genbank accession: NM_016021
Immunogen: UBE2J1 (NP_003329, 9 a.a. ~ 118 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGF
Protein accession: NP_003329
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051465-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UBE2J1 polyclonal antibody (A01) now

Add to cart