GPR89 monoclonal antibody (M01), clone 4D8 View larger

GPR89 monoclonal antibody (M01), clone 4D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPR89 monoclonal antibody (M01), clone 4D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about GPR89 monoclonal antibody (M01), clone 4D8

Brand: Abnova
Reference: H00051463-M01
Product name: GPR89 monoclonal antibody (M01), clone 4D8
Product description: Mouse monoclonal antibody raised against a partial recombinant GPR89.
Clone: 4D8
Isotype: IgG2b Kappa
Gene id: 51463
Gene name: GPR89B
Gene alias: GPHR|GPR89|SH120
Gene description: G protein-coupled receptor 89B
Genbank accession: BC003187
Immunogen: GPR89 (AAH03187, 175 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKTFKGK
Protein accession: AAH03187
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051463-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged GPR89 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy GPR89 monoclonal antibody (M01), clone 4D8 now

Add to cart