SFMBT1 monoclonal antibody (M02), clone 2A1 View larger

SFMBT1 monoclonal antibody (M02), clone 2A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFMBT1 monoclonal antibody (M02), clone 2A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about SFMBT1 monoclonal antibody (M02), clone 2A1

Brand: Abnova
Reference: H00051460-M02
Product name: SFMBT1 monoclonal antibody (M02), clone 2A1
Product description: Mouse monoclonal antibody raised against a partial recombinant SFMBT1.
Clone: 2A1
Isotype: IgG2a Kappa
Gene id: 51460
Gene name: SFMBT1
Gene alias: DKFZp434L243|RU1|SFMBT
Gene description: Scm-like with four mbt domains 1
Genbank accession: NM_016329
Immunogen: SFMBT1 (NP_057413, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQ
Protein accession: NP_057413
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051460-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051460-M02-13-15-1.jpg
Application image note: Western Blot analysis of SFMBT1 expression in transfected 293T cell line by SFMBT1 monoclonal antibody (M02), clone 2A1.

Lane 1: SFMBT1 transfected lysate(98.141 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SFMBT1 monoclonal antibody (M02), clone 2A1 now

Add to cart