RHCG monoclonal antibody (M06), clone 5A4 View larger

RHCG monoclonal antibody (M06), clone 5A4

H00051458-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHCG monoclonal antibody (M06), clone 5A4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,ELISA,WB-Re

More info about RHCG monoclonal antibody (M06), clone 5A4

Brand: Abnova
Reference: H00051458-M06
Product name: RHCG monoclonal antibody (M06), clone 5A4
Product description: Mouse monoclonal antibody raised against a partial recombinant RHCG.
Clone: 5A4
Isotype: IgG2a Kappa
Gene id: 51458
Gene name: RHCG
Gene alias: C15orf6|PDRC2|RHGK|SLC42A3
Gene description: Rh family, C glycoprotein
Genbank accession: NM_016321
Immunogen: RHCG (NP_057405, 418 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP
Protein accession: NP_057405
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051458-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00051458-M06-3-6-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Remodeling of the Fetal Collecting Duct Epithelium.Hiatt MJ, Ivanova L, Toran N, Tarantal AF, Matsell DG.
Am J Pathol. 2010 Feb;176(2):630-7. Epub 2009 Dec 24.

Reviews

Buy RHCG monoclonal antibody (M06), clone 5A4 now

Add to cart