REV1L polyclonal antibody (A01) View larger

REV1L polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of REV1L polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about REV1L polyclonal antibody (A01)

Brand: Abnova
Reference: H00051455-A01
Product name: REV1L polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant REV1L.
Gene id: 51455
Gene name: REV1
Gene alias: FLJ21523|MGC163283|MGC26225|REV1L
Gene description: REV1 homolog (S. cerevisiae)
Genbank accession: NM_016316
Immunogen: REV1L (NP_057400, 1097 a.a. ~ 1194 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SPAKTLPGACGSPQKLIDGFLKHEGPPAEKPLEELSASTSGVPGLSSLQSDPAGCVRPPAPNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYC
Protein accession: NP_057400
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051455-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy REV1L polyclonal antibody (A01) now

Add to cart