IP6K2 monoclonal antibody (M04), clone 1C6 View larger

IP6K2 monoclonal antibody (M04), clone 1C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IP6K2 monoclonal antibody (M04), clone 1C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IP6K2 monoclonal antibody (M04), clone 1C6

Brand: Abnova
Reference: H00051447-M04
Product name: IP6K2 monoclonal antibody (M04), clone 1C6
Product description: Mouse monoclonal antibody raised against a partial recombinant IP6K2.
Clone: 1C6
Isotype: IgG2a Kappa
Gene id: 51447
Gene name: IP6K2
Gene alias: IHPK2|PiUS
Gene description: inositol hexakisphosphate kinase 2
Genbank accession: NM_001005912
Immunogen: IP6K2 (NP_001005912.1, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSPAFRAMDVEPRAKGVLLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMRKFTPQYKGVS
Protein accession: NP_001005912.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051447-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (33.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051447-M04-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged IP6K2 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IP6K2 monoclonal antibody (M04), clone 1C6 now

Add to cart