RNF138 polyclonal antibody (A01) View larger

RNF138 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF138 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RNF138 polyclonal antibody (A01)

Brand: Abnova
Reference: H00051444-A01
Product name: RNF138 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RNF138.
Gene id: 51444
Gene name: RNF138
Gene alias: HSD-4|MGC8758|NARF|STRIN
Gene description: ring finger protein 138
Genbank accession: NM_016271
Immunogen: RNF138 (NP_055369, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYRMRHHYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTS
Protein accession: NP_055369
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051444-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNF138 polyclonal antibody (A01) now

Add to cart