VGLL1 monoclonal antibody (M01), clone 3C7 View larger

VGLL1 monoclonal antibody (M01), clone 3C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VGLL1 monoclonal antibody (M01), clone 3C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about VGLL1 monoclonal antibody (M01), clone 3C7

Brand: Abnova
Reference: H00051442-M01
Product name: VGLL1 monoclonal antibody (M01), clone 3C7
Product description: Mouse monoclonal antibody raised against a partial recombinant VGLL1.
Clone: 3C7
Isotype: IgG1 Kappa
Gene id: 51442
Gene name: VGLL1
Gene alias: TDU|VGL1
Gene description: vestigial like 1 (Drosophila)
Genbank accession: NM_016267
Immunogen: VGLL1 (NP_057351.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAA
Protein accession: NP_057351.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00051442-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051442-M01-13-15-1.jpg
Application image note: Western Blot analysis of VGLL1 expression in transfected 293T cell line by VGLL1 monoclonal antibody (M01), clone 3C7.

Lane 1: VGLL1 transfected lysate(28.7 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VGLL1 monoclonal antibody (M01), clone 3C7 now

Add to cart