VGLL1 purified MaxPab mouse polyclonal antibody (B02P) View larger

VGLL1 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VGLL1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about VGLL1 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00051442-B02P
Product name: VGLL1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human VGLL1 protein.
Gene id: 51442
Gene name: VGLL1
Gene alias: TDU|VGL1
Gene description: vestigial like 1 (Drosophila)
Genbank accession: NM_016267.2
Immunogen: VGLL1 (NP_057351.1, 1 a.a. ~ 258 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTSSLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGHPHRYLQHL
Protein accession: NP_057351.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051442-B02P-13-15-1.jpg
Application image note: Western Blot analysis of VGLL1 expression in transfected 293T cell line (H00051442-T02) by VGLL1 MaxPab polyclonal antibody.

Lane 1: VGLL1 transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VGLL1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart