Brand: | Abnova |
Reference: | H00051440-M01 |
Product name: | HPCAL4 monoclonal antibody (M01), clone 2B11 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant HPCAL4. |
Clone: | 2B11 |
Isotype: | IgG2a kappa |
Gene id: | 51440 |
Gene name: | HPCAL4 |
Gene alias: | DKFZp761G122|HLP4 |
Gene description: | hippocalcin like 4 |
Genbank accession: | BC030827 |
Immunogen: | HPCAL4 (AAH30827, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK |
Protein accession: | AAH30827 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (46.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HPCAL4 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |