SNX9 MaxPab rabbit polyclonal antibody (D01) View larger

SNX9 MaxPab rabbit polyclonal antibody (D01)

H00051429-D01_100uL

New product

384,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX9 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about SNX9 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00051429-D01
Product name: SNX9 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human SNX9 protein.
Gene id: 51429
Gene name: SNX9
Gene alias: MST155|MSTP155|SDP1|SH3PX1|SH3PXD3A|WISP
Gene description: sorting nexin 9
Genbank accession: NM_016224
Immunogen: SNX9 (NP_057308.1, 1 a.a. ~ 595 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Protein accession: NP_057308.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00051429-D01-31-15-1.jpg
Application image note: Immunoprecipitation of SNX9 transfected lysate using anti-SNX9 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SNX9 MaxPab rabbit polyclonal antibody (D01) (H00051429-D01).
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy SNX9 MaxPab rabbit polyclonal antibody (D01) now

Add to cart