Brand: | Abnova |
Reference: | H00051428-M01 |
Product name: | DDX41 monoclonal antibody (M01), clone 2F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DDX41. |
Clone: | 2F4 |
Isotype: | IgG1 Kappa |
Gene id: | 51428 |
Gene name: | DDX41 |
Gene alias: | ABS|MGC8828 |
Gene description: | DEAD (Asp-Glu-Ala-Asp) box polypeptide 41 |
Genbank accession: | NM_016222 |
Immunogen: | DDX41 (NP_057306, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TGRSGNTGIATTFINKACDESVLMDLKALLLEAKQKVPPVLQVLHCGDESMLDIGGERGCAFCGGLGHRITDCPKLEAMQTKQVSNIGRKDYLAHSSMDF |
Protein accession: | NP_057306 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to DDX41 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Structural and Functional Analysis of DDX41: a bispecific immune receptor for DNA and cyclic dinucleotide.Omura H, Oikawa D, Nakane T, Kato M, Ishii R, Ishitani R, Tokunaga F, Nureki O. Sci Rep. 2016 Oct 10;6:34756. |