Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRAPPC4 monoclonal antibody (M01), clone 2D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about TRAPPC4 monoclonal antibody (M01), clone 2D10
| Brand: | Abnova |
| Reference: | H00051399-M01 |
| Product name: | TRAPPC4 monoclonal antibody (M01), clone 2D10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TRAPPC4. |
| Clone: | 2D10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51399 |
| Gene name: | TRAPPC4 |
| Gene alias: | CGI-104|HSPC172|PTD009|SBDN|SYNBINDIN|TRS23 |
| Gene description: | trafficking protein particle complex 4 |
| Genbank accession: | BC010866 |
| Immunogen: | TRAPPC4 (AAH10866, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS |
| Protein accession: | AAH10866 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (49.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | TRAPPC4 monoclonal antibody (M01), clone 2D10 Western Blot analysis of TRAPPC4 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The Role of ERK2 in Colorectal Carcinogenesis Is Partly Regulated by TRAPPC4.Weng YR, Kong X, Yu YN, Wang YC, Hong J, Zhao SL, Fang JY Mol Carcinog. 2013 Apr 26. doi: 10.1002/mc.22031. |