Brand: | Abnova |
Reference: | H00051380-M02A |
Product name: | CSAD monoclonal antibody (M02A), clone 2C11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CSAD. |
Clone: | 2C11 |
Isotype: | IgG2a Kappa |
Gene id: | 51380 |
Gene name: | CSAD |
Gene alias: | CSD|FLJ44987|FLJ45500|MGC119354|MGC119355|MGC119357|PCAP |
Gene description: | cysteine sulfinic acid decarboxylase |
Genbank accession: | NM_015989 |
Immunogen: | CSAD (NP_057073, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLD |
Protein accession: | NP_057073 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CSAD monoclonal antibody (M02A), clone 2C11. Western Blot analysis of CSAD expression in HepG2(Cat # L019V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |