Brand: | Abnova |
Reference: | H00051378-M01 |
Product name: | ANGPT4 monoclonal antibody (M01), clone 1B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ANGPT4. |
Clone: | 1B7 |
Isotype: | IgG2b Kappa |
Gene id: | 51378 |
Gene name: | ANGPT4 |
Gene alias: | AGP4|ANG-3|ANG4|MGC138181|MGC138183 |
Gene description: | angiopoietin 4 |
Genbank accession: | NM_015985 |
Immunogen: | ANGPT4 (NP_057069, 25 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTI |
Protein accession: | NP_057069 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ANGPT4 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |