Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of C2orf28 monoclonal antibody (M11), clone 1D2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about C2orf28 monoclonal antibody (M11), clone 1D2
| Brand: | Abnova |
| Reference: | H00051374-M11 |
| Product name: | C2orf28 monoclonal antibody (M11), clone 1D2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant C2orf28. |
| Clone: | 1D2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51374 |
| Gene name: | C2orf28 |
| Gene alias: | APR--3|APR-3|APR3|HSPC013|PRO240|p18 |
| Gene description: | chromosome 2 open reading frame 28 |
| Genbank accession: | BC011006 |
| Immunogen: | C2orf28 (AAH11006, 1 a.a. ~ 171 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDLQANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS |
| Protein accession: | AAH11006 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |