Brand: | Abnova |
Reference: | H00051368-M01A |
Product name: | TEX264 monoclonal antibody (M01A), clone S3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TEX264. |
Clone: | S3 |
Isotype: | IgG2b Kappa |
Gene id: | 51368 |
Gene name: | TEX264 |
Gene alias: | DKFZp451H0417|FLJ13935|SIG11|ZSIG11 |
Gene description: | testis expressed 264 |
Genbank accession: | BC008742 |
Immunogen: | TEX264 (AAH08742, 1 a.a. ~ 313 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE |
Protein accession: | AAH08742 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (60.17 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TEX264 monoclonal antibody (M01A), clone 2A3-1A10 Western Blot analysis of TEX264 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |