Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ZBTB7A monoclonal antibody (M07), clone 2A2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA |
More info about ZBTB7A monoclonal antibody (M07), clone 2A2
| Brand: | Abnova |
| Reference: | H00051341-M07 |
| Product name: | ZBTB7A monoclonal antibody (M07), clone 2A2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ZBTB7A. |
| Clone: | 2A2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51341 |
| Gene name: | ZBTB7A |
| Gene alias: | DKFZp547O146|FBI-1|FBI1|LRF|MGC99631|ZBTB7|ZNF857A|pokemon |
| Gene description: | zinc finger and BTB domain containing 7A |
| Genbank accession: | BC019108 |
| Immunogen: | ZBTB7A (AAH19108, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMVLVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKPSVVAERGA |
| Protein accession: | AAH19108 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ZBTB7A is 3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |