Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DACT1 monoclonal antibody (M03), clone 5D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about DACT1 monoclonal antibody (M03), clone 5D8
| Brand: | Abnova |
| Reference: | H00051339-M03 |
| Product name: | DACT1 monoclonal antibody (M03), clone 5D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DACT1. |
| Clone: | 5D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51339 |
| Gene name: | DACT1 |
| Gene alias: | DAPPER|DAPPER1|DPR1|FRODO|HDPR1|THYEX3 |
| Gene description: | dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis) |
| Genbank accession: | NM_016651 |
| Immunogen: | DACT1 (NP_057735.2, 738 a.a. ~ 836 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV |
| Protein accession: | NP_057735.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DACT1 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |